Cardiac Troponin T (TNNT2) (NM_001001432) Human Recombinant Protein
CAT#: TP314299
Purified recombinant protein of Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 4, 20 µg
View other "Cardiac Troponin T" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214299 representing NM_001001432
Red=Cloning site Green=Tags(s) MSDIEEVVEEYEEEEQEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLV PPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQRIRNERE KERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKAQTERKSGKRQTEREKKKKILAERR KVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGR WK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001001432 |
Locus ID | 7139 |
UniProt ID | P45379 |
Refseq Size | 1114 |
Cytogenetics | 1q32.1 |
Refseq ORF | 846 |
Synonyms | CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC |
Summary | The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400130 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424349 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424350 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424351 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400130 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 1 |
CNY 3080.00 |
|
LY424349 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 2 |
CNY 3080.00 |
|
LY424350 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 3 |
CNY 3080.00 |
|
LY424351 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 4 |
CNY 3080.00 |
|
PH301218 | TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001431) |
CNY 19520.00 |
|
PH314180 | TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_000355) |
CNY 19520.00 |
|
PH314241 | TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001430) |
CNY 14250.00 |
|
PH314299 | TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001432) |
CNY 14250.00 |
|
TP301218 | Recombinant protein of human troponin T type 2 (cardiac) (TNNT2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP314180 | Recombinant protein of human troponin T type 2 (cardiac) (TNNT2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP314241 | Purified recombinant protein of Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP750172 | Purified recombinant protein of Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50 ug |
CNY 2040.00 |
其它Cardiac Troponin T产品