PHOSPHO1 (NM_178500) Human Recombinant Protein
CAT#: TP314434
Recombinant protein of human phosphatase, orphan 1 (PHOSPHO1), 20 µg
View other "PHOSPHO1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214434 protein sequence
Red=Cloning site Green=Tags(s) MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNE YMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHS LFRRILSNPSGPDARGLLALRPFHTHSCARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCP MGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848595 |
Locus ID | 162466 |
UniProt ID | Q8TCT1 |
Refseq Size | 2046 |
Cytogenetics | 17q21.32 |
Refseq ORF | 801 |
Summary | Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerophospholipid metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Glycolytic flux control by drugging phosphoglycolate phosphatase
,null,
Nature Communications
,PubMed ID 36369173
[PHOSPHO1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405893 | PHOSPHO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428350 | PHOSPHO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405893 | Transient overexpression lysate of phosphatase, orphan 1 (PHOSPHO1), transcript variant 2 |
CNY 3080.00 |
|
LY428350 | Transient overexpression lysate of phosphatase, orphan 1 (PHOSPHO1), transcript variant 1 |
CNY 3080.00 |
|
PH314434 | PHOSPHO1 MS Standard C13 and N15-labeled recombinant protein (NP_848595) |
CNY 19520.00 |
其它PHOSPHO1产品