PPAR delta (PPARD) (NM_006238) Human Recombinant Protein
CAT#: TP314735
Recombinant protein of human peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1, 20 µg
View other "PPAR delta" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214735 representing NM_006238
Red=Cloning site Green=Tags(s) MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSL NMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSH NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAP FVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVT LLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLAL FIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI KKTETETSLHPLLQEIYKDMY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006229 |
Locus ID | 5467 |
UniProt ID | Q03181 |
Refseq Size | 3328 |
Cytogenetics | 6p21.31 |
Refseq ORF | 1323 |
Synonyms | FAAR; NR1C2; NUC1; NUCI; NUCII; PPARB |
Summary | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcriptional activity of peroxisome proliferator activated receptors alpha and gamma, though evidence for this effect is inconsistent. Expression of this gene in colorectal cancer cells may be variable but is typically relatively low. Knockout studies in mice suggested a role for this protein in myelination of the corpus callosum, lipid metabolism, differentiation, and epidermal cell proliferation. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Pathways in cancer, PPAR signaling pathway, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416782 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC432912 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433008 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433089 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416782 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1 |
CNY 4840.00 |
|
LY432912 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 5 |
CNY 3080.00 |
|
LY433008 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 4 |
CNY 3080.00 |
|
LY433089 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 3 |
CNY 3080.00 |
|
PH314735 | PPARD MS Standard C13 and N15-labeled recombinant protein (NP_006229) |
CNY 19520.00 |
其它PPAR delta产品