ZNF205 (NM_003456) Human Recombinant Protein
CAT#: TP314738
Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 1, 20 µg
View other "ZNF205" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214738 protein sequence
Red=Cloning site Green=Tags(s) MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDAQESLHIKMEPEEPHSEGASQEDGAQGA WGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGR LDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTS SVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPE KPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSH LIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSH LTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003447 |
Locus ID | 7755 |
UniProt ID | O95201 |
Refseq Size | 2077 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1662 |
Synonyms | RhitH; Zfp13; ZNF210 |
Summary | May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418666 | ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420898 | ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418666 | Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 1 |
CNY 3080.00 |
|
LY420898 | Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 2 |
CNY 3080.00 |
|
PH301174 | ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_001035893) |
CNY 14250.00 |
|
PH314738 | ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_003447) |
CNY 14250.00 |
|
TP301174 | Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP761639 | Purified recombinant protein of Human zinc finger protein 205 (ZNF205), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |