MOCS2 (NM_176806) Human Recombinant Protein
CAT#: TP314804
Recombinant protein of human molybdenum cofactor synthesis 2 (MOCS2), transcript variant 1, 20 µg
View other "MOCS2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214804 representing NM_176806
Red=Cloning site Green=Tags(s) MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQL LVLQPGDEIAVIPPISGG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_789776 |
Locus ID | 4338 |
UniProt ID | O96033 |
Refseq Size | 1347 |
Cytogenetics | 5q11.2 |
Refseq ORF | 264 |
Synonyms | MCBPE; MOCO1; MOCODB; MPTS |
Summary | Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406129 | MOCS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417924 | MOCS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406129 | Transient overexpression lysate of molybdenum cofactor synthesis 2 (MOCS2), transcript variant 1 |
CNY 3080.00 |
|
LY417924 | Transient overexpression lysate of molybdenum cofactor synthesis 2 (MOCS2), transcript variant 3 |
CNY 3080.00 |
|
PH308485 | MOCS2 MS Standard C13 and N15-labeled recombinant protein (NP_004522) |
CNY 19520.00 |
|
PH314804 | MOCS2 MS Standard C13 and N15-labeled recombinant protein (NP_789776) |
CNY 19520.00 |
|
TP308485 | Recombinant protein of human molybdenum cofactor synthesis 2 (MOCS2), transcript variant 3, 20 µg |
CNY 2900.00 |