EGFR (NM_201283) Human Recombinant Protein
CAT#: TP314877
Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3, 20 µg
View other "EGFR" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214877 representing NM_201283
Red=Cloning site Green=Tags(s) MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYV QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNL QEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKL TKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVN PEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_958440 |
| Locus ID | 1956 |
| UniProt ID | P00533 |
| Refseq Size | 1595 |
| Cytogenetics | 7p11.2 |
| Refseq ORF | 1215 |
| Synonyms | ERBB; ERBB1; ERRP; HER1; mENA; NISBD2; PIG61 |
| Summary | The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). [provided by RefSeq, Jul 2020] |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Secreted Protein, Stem cell relevant signaling - JAK/STAT signaling pathway, Transmembrane |
| Protein Pathways | Adherens junction, Bladder cancer, Calcium signaling pathway, Colorectal cancer, Cytokine-cytokine receptor interaction, Dorso-ventral axis formation, Endocytosis, Endometrial cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, MAPK signaling pathway, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Photoinduced Ligand Release from a Silicon Phthalocyanine Dye Conjugated with Monoclonal Antibodies: A Mechanism of Cancer Cell Cytotoxicity after Near-Infrared Photoimmunotherapy
,Sato, K;Ando, K;Okuyama, S;Moriguchi, S;Ogura, T;Totoki, S;Hanaoka, H;Nagaya, T;Kokawa, R;Takakura, H;Nishimura, M;Hasegawa, Y;Choyke, P;Ogawa, M;Kobayashi, H;,
ACS Cent. Sci.
,PubMed ID 30555909
[EGFR]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404514 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404515 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417434 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY404514 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 2 |
CNY 4840.00 |
|
| LY404515 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3 |
CNY 3080.00 |
|
| LY417434 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 1 |
CNY 4840.00 |
|
| PH314877 | EGFR MS Standard C13 and N15-labeled recombinant protein (NP_958440) |
CNY 19520.00 |
|
| TP700043 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 25-645 aa, expressed in human cells |
CNY 6650.00 |
|
| TP700065 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant L858R, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6650.00 |
|
| TP700080 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant K745_K750del, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6650.00 |
|
| TP700103 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
| TP700204 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR) extracellular domain, residues Leu25-Gly378, transcript variant 3 |
CNY 2900.00 |
|
| TP710003 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 1-645aa,expressed in sf9 cells |
CNY 4020.00 |
|
| TP710011 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4020.00 |
|
| TP710358 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 1, esidues 669-1210aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |

