CHMP1A (NM_002768) Human Recombinant Protein
CAT#: TP314991
Purified recombinant protein of Homo sapiens chromatin modifying protein 1A (CHMP1A), transcript variant 2, 20 µg
View other "CHMP1A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214991 representing NM_002768
Red=Cloning site Green=Tags(s) MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVD AVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLT TPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002759 |
Locus ID | 5119 |
UniProt ID | Q9HD42 |
Refseq Size | 2474 |
Cytogenetics | 16q24.3 |
Refseq ORF | 588 |
Synonyms | CHMP1; PCH8; PCOLN3; PRSM1; VPS46-1; VPS46A |
Summary | This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419102 | CHMP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421212 | CHMP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419102 | Transient overexpression lysate of chromatin modifying protein 1A (CHMP1A), transcript variant 2 |
CNY 3080.00 |
|
LY421212 | Transient overexpression lysate of chromatin modifying protein 1A (CHMP1A), transcript variant 1 |
CNY 3080.00 |
|
PH314991 | CHMP1A MS Standard C13 and N15-labeled recombinant protein (NP_002759) |
CNY 14250.00 |