PPP1R11 (NM_021959) Human Recombinant Protein
CAT#: TP314995
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 11 (PPP1R11), 20 µg
View other "PPP1R11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214995 representing NM_021959
Red=Cloning site Green=Tags(s) MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF GESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_068778 |
| Locus ID | 6992 |
| UniProt ID | O60927 |
| Refseq Size | 1620 |
| Cytogenetics | 6p22.1 |
| Refseq ORF | 378 |
| Synonyms | CFAP255; HCG-V; HCGV; IPP3; TCTE5; TCTEX5 |
| Summary | This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411854 | PPP1R11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411854 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 11 (PPP1R11) |
CNY 3080.00 |
|
| PH314995 | PPP1R11 MS Standard C13 and N15-labeled recombinant protein (NP_068778) |
CNY 19520.00 |
其它PPP1R11产品

