ETS1 (NM_005238) Human Recombinant Protein
CAT#: TP315203
Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 2, 20 µg
View other "ETS1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215203 representing NM_005238
Red=Cloning site Green=Tags(s) MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPR QWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPY QVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVIL RDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSC QSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS LLGYTPEELHAMLDVKPDADE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ETS1 Activity Verified in a DNA-binding Assay: ETS1 (TP315203) activity was measured in a colorimetric DNA-binding assay. Purified ETS1 protein containing a C-terminal MYC/DDK tag was incubated with biotinylated double-stranded oligonucleotide containing the ETS1 consensus DNA-binding sequence. Following incubation, the reaction was transferred to a streptavidin-coated microplate to allow capture of the protein-DNA complex. After washing, the captured protein was detected with an anti-DDK peroxidase conjugate and colorimetric signal detection with TMB. Specificity of the protein-DNA interaction was confirmed by carrying out the binding in the presence of an unlabeled competitor oligonucleotide and by comparison to binding to an oligonucleotide containing a mutation in the consensus binding sequence. |
Reference Data | |
RefSeq | NP_005229 |
Locus ID | 2113 |
UniProt ID | P14921 |
Refseq Size | 5228 |
Cytogenetics | 11q24.3 |
Refseq ORF | 1323 |
Synonyms | c-ets-1; ETS-1; EWSR2; p54 |
Summary | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401606 | ETS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC428365 | ETS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401606 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 2 |
CNY 4840.00 |
|
LY428365 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 1 |
CNY 3080.00 |
|
PH315203 | ETS1 MS Standard C13 and N15-labeled recombinant protein (NP_005229) |
CNY 19520.00 |
|
TP761465 | Purified recombinant protein of Human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |