TENT5C (NM_017709) Human Recombinant Protein
CAT#: TP315475
Recombinant protein of human family with sequence similarity 46, member C (FAM46C), 20 µg
View other "TENT5C" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215475 protein sequence
Red=Cloning site Green=Tags(s) MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVR LNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQ KLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTV IGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPD ILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA TNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060179 |
| Locus ID | 54855 |
| UniProt ID | Q5VWP2 |
| Refseq Size | 5720 |
| Cytogenetics | 1p12 |
| Refseq ORF | 1173 |
| Synonyms | FAM46C |
| Summary | Nucleotidyltransferase that act as a non-canonical poly(A) RNA polymerase which enhances mRNA stability and gene expression. Mainly targets mRNAs encoding endoplasmic reticulum-targeted protein and may be involved in induction of cell death.[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
FAM46C/TENT5C functions as a tumor suppressor through inhibition of Plk4 activity
,Kazazian, K;Haffani, Y;Ng, D;Lee, CMM;Johnston, W;Kim, M;Xu, R;Pacholzyk, K;Zih, FS;Tan, J;Smrke, A;Pollett, A;Wu, HS;Swallow, CJ;,
Commun Biol
,PubMed ID 32807875
[TENT5C]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413617 | FAM46C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413617 | Transient overexpression lysate of family with sequence similarity 46, member C (FAM46C) |
CNY 3080.00 |
|
| PH315475 | FAM46C MS Standard C13 and N15-labeled recombinant protein (NP_060179) |
CNY 19520.00 |


