Morg1 (WDR83) (NM_001099737) Human Recombinant Protein
CAT#: TP315520
Purified recombinant protein of Homo sapiens mitogen-activated protein kinase organizer 1 (MORG1), transcript variant 1, 20 µg
View other "Morg1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215520 protein sequence
Red=Cloning site Green=Tags(s) MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV LDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRS RRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSS LDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVV QSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001093207 |
| Locus ID | 84292 |
| UniProt ID | Q9BRX9 |
| Refseq Size | 1476 |
| Cytogenetics | 19p13.13 |
| Refseq ORF | 945 |
| Synonyms | MORG1 |
| Summary | This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403158 | WDR83 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420510 | WDR83 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403158 | Transient overexpression lysate of WD repeat domain 83 (WDR83), transcript variant 2 |
CNY 3080.00 |
|
| LY420510 | Transient overexpression lysate of WD repeat domain 83 (WDR83), transcript variant 1 |
CNY 3080.00 |
|
| PH301323 | WDR83 MS Standard C13 and N15-labeled recombinant protein (NP_115708) |
CNY 19520.00 |
|
| PH315520 | WDR83 MS Standard C13 and N15-labeled recombinant protein (NP_001093207) |
CNY 14250.00 |
|
| TP301323 | Recombinant protein of human mitogen-activated protein kinase organizer 1 (MORG1), transcript variant 2, 20 µg |
CNY 2900.00 |
