PANK2 (NM_153638) Human Recombinant Protein
CAT#: TP315676
Recombinant protein of human pantothenate kinase 2 (PANK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "PANK2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215676 representing NM_153638
Red=Cloning site Green=Tags(s) MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRVREPTGREAFG PSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRLLLRMGGGRLGAPMERHGRAS ATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAEGTRRDRLGSYSGPTSVSRQRVESLRKKRPL FPWFGLDIGGTLVKLVYFEPKDITAEEEEEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKG NLHFIRFPTHDMPAFIQMGRDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYID SVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEKREAVSKEDLA RATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDYWSKGQLKALFSEHEGYFGAV GALLELLKIP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 59.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_705902 |
| Locus ID | 80025 |
| UniProt ID | Q9BZ23 |
| Refseq Size | 2280 |
| Cytogenetics | 20p13 |
| Refseq ORF | 1710 |
| Synonyms | C20orf48; HARP; HSS; NBIA1; PKAN |
| Summary | This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406998 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406999 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410958 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406998 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 4840.00 |
|
| LY406999 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 2 |
CNY 3080.00 |
|
| LY410958 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 3 |
CNY 3080.00 |
|
| PH315676 | PANK2 MS Standard C13 and N15-labeled recombinant protein (NP_705902) |
CNY 19520.00 |
