Endonuclease V (ENDOV) (NM_173627) Human Recombinant Protein
CAT#: TP315740
Recombinant protein of human hypothetical protein FLJ35220 (FLJ35220), 20 µg
View other "Endonuclease V" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215740 representing NM_173627
Red=Cloning site Green=Tags(s) MALEAAGGPPEETLSLWKREQARLKAHVVDRDTEAWQRDPAFSGLQRVGGVDVSFVKGDSVRACASLVVL SFPELEVVYEESRMVSLTAPYVSGFLAFREVPFLLELVQQLREKEPGLMPQVLLVDGNGVLHHRGFGVAC HLGVLTDLPCVGVAKKLLQVDGLENNALHKEKIRLLQTRGDSFPLLGDSGTVLGMALRSHDRSTRPLYIS VGHRMSLEAAVRLTCCCCRFRIPEPVRQADICSREHIRKSLGLPGPPTPRSPKAQRPVACPKGDSGESSA LC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_775898 |
| Locus ID | 284131 |
| UniProt ID | Q8N8Q3 |
| Refseq Size | 2858 |
| Cytogenetics | 17q25.3 |
| Refseq ORF | 846 |
| Summary | Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Has strong preference for single-stranded RNAs (ssRNAs) toward double-stranded RNAs (dsRNAs). Cleaves mRNAs and tRNAs containing inosine. Also able to cleave structure-specific dsRNA substrates containing the specific sites 5'-IIUI-3' and 5'-UIUU-3'. Inosine is present in a number of RNAs following editing; the function of inosine-specific endoribonuclease is still unclear: it could either play a regulatory role in edited RNAs, or be involved in antiviral response by removing the hyperedited long viral dsRNA genome that has undergone A-to-I editing. Binds branched DNA structures.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406516 | ENDOV HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431196 | ENDOV HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406516 | Transient overexpression lysate of hypothetical protein FLJ35220 (FLJ35220), transcript variant 1 |
CNY 3080.00 |
|
| LY431196 | Transient overexpression lysate of endonuclease V (ENDOV), transcript variant 2 |
CNY 3080.00 |
|
| PH315740 | FLJ35220 MS Standard C13 and N15-labeled recombinant protein (NP_775898) |
CNY 19520.00 |
其它Endonuclease V产品
