WDR5 (NM_017588) Human Recombinant Protein
CAT#: TP316218
Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 1, 20 µg
View other "WDR5" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC216218 representing NM_017588 
Red=Cloning site Green=Tags(s) MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 36.4 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_060058 | 
| Locus ID | 11091 | 
| UniProt ID | P61964 | 
| Refseq Size | 3163 | 
| Cytogenetics | 9q34.2 | 
| Refseq ORF | 1002 | 
| Synonyms | BIG-3; CFAP89; SWD3 | 
| Summary | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402599 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC409441 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402599 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY409441 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH300162 | WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_438172) | 
                                                     CNY 19520.00  | 
                                            |
| PH316218 | WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_060058) | 
                                                     CNY 19520.00  | 
                                            |
| TP300162 | Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
