IGF2BP1 (NM_006546) Human Recombinant Protein
CAT#: TP316226
Recombinant protein of human insulin-like growth factor 2 mRNA binding protein 1 (IGF2BP1), 20 µg
View other "IGF2BP1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216226 representing NM_006546
Red=Cloning site Green=Tags(s) MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEI EHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLN GHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAI IGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLK ILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREA YENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLET HIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQV KQQHQKGQSNQAQARRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA assay (PMID: 27068461) |
Reference Data | |
RefSeq | NP_006537 |
Locus ID | 10642 |
UniProt ID | Q9NZI8 |
Refseq Size | 8769 |
Cytogenetics | 17q21.32 |
Refseq ORF | 1731 |
Synonyms | CRD-BP; CRDBP; IMP-1; IMP1; VICKZ1; ZBP1 |
Summary | This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Dynamic expression of tRNA-derived small RNAs define cellular states
,Krishna, S;Yim, DG;Lakshmanan, V;Tirumalai, V;Koh, JL;Park, JE;Cheong, JK;Low, JL;Lim, MJ;Sze, SK;Shivaprasad, P;Gulyani, A;Raghavan, S;Palakodeti, D;DasGupta, R;,
EMBO Rep.
,PubMed ID 31267708
[IGF2BP1]
|
Enhanced CLIP Uncovers IMP Protein-RNA Targets in Human Pluripotent Stem Cells Important for Cell Adhesion and Survival
,Conway, AE;Van Nostrand, EL;Pratt, GA;Aigner, S;Wilbert, ML;Sundararaman, B;Freese, P;Lambert, NJ;Sathe, S;Liang, TY;Essex, A;Landais, S;Burge, CB;Jones, DL;Yeo, GW;,
Cell Rep
,PubMed ID 27068461
[IGF2BP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401963 | IGF2BP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC431377 | IGF2BP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401963 | Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 1 (IGF2BP1), transcript variant 1 |
CNY 4840.00 |
|
LY431377 | Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 1 (IGF2BP1), transcript variant 2 |
CNY 3080.00 |
|
PH316226 | IGF2BP1 MS Standard C13 and N15-labeled recombinant protein (NP_006537) |
CNY 19520.00 |
|
TP762408 | Purified recombinant protein of Human insulin-like growth factor 2 mRNA binding protein 1 (IGF2BP1), transcript variant 1, Met1-300Lys, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
其它IGF2BP1产品