PKIB (NM_181794) Human Recombinant Protein
CAT#: TP316291
Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2, 20 µg
View other "PKIB" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216291 protein sequence
Red=Cloning site Green=Tags(s) MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL EKPQNEEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_861459 |
Locus ID | 5570 |
UniProt ID | Q9C010 |
Refseq Size | 1892 |
Cytogenetics | 6q22.31 |
Refseq ORF | 234 |
Synonyms | PRKACN2 |
Summary | This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405587 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405588 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410103 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405587 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2 |
CNY 3080.00 |
|
LY405588 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1 |
CNY 3080.00 |
|
LY410103 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 |
CNY 3080.00 |
|
PH312372 | PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861460) |
CNY 19520.00 |
|
PH316291 | PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861459) |
CNY 19520.00 |
|
TP312372 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720220 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 |
CNY 1800.00 |
|
TP761370 | Purified recombinant protein of Human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |