BTN3A1 (NM_007048) Human Recombinant Protein
CAT#: TP316344
Recombinant protein of human butyrophilin, subfamily 3, member A1 (BTN3A1), transcript variant 1, 20 µg
View other "BTN3A1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216344 protein sequence
Red=Cloning site Green=Tags(s) MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKTPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF SEALYPVFRILTLEPTALTICPA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_008979 |
| Locus ID | 11119 |
| UniProt ID | O00481 |
| Refseq Size | 3434 |
| Cytogenetics | 6p22.2 |
| Refseq ORF | 1539 |
| Synonyms | BT3.1; BTF5; BTN3.1; CD277 |
| Summary | The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A1) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010 [PubMed 20208008]).[supplied by OMIM, Nov 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416231 | BTN3A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428640 | BTN3A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416231 | Transient overexpression lysate of butyrophilin, subfamily 3, member A1 (BTN3A1), transcript variant 1 |
CNY 4840.00 |
|
| LY428640 | Transient overexpression lysate of butyrophilin, subfamily 3, member A1 (BTN3A1), transcript variant 4 |
CNY 3080.00 |
|
| PH316344 | BTN3A1 MS Standard C13 and N15-labeled recombinant protein (NP_008979) |
CNY 19520.00 |
|
| TP723969 | Human BTN3A1 Protein, mFc-His Tag |
CNY 5249.00 |
