PMP22 (NM_000304) Human Recombinant Protein
CAT＃: TP316500
Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 1, 20 µg
View other "PMP22" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216500 protein sequence
Red=Cloning site Green=Tags(s) MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMI LSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAW VAFPLALLSGVIYVILRKRE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000295 |
| Locus ID | 5376 |
| UniProt ID | Q01453 |
| Refseq Size | 1861 |
| Cytogenetics | 17p12 |
| Refseq ORF | 480 |
| Synonyms | CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110 |
| Summary | This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Studies suggest two alternately used promoters drive tissue-specific expression. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403508 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407108 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424810 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430266 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403508 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 3 |
CNY 3080.00 |
|
| LY407108 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 2 |
CNY 3080.00 |
|
| LY424810 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 1 |
CNY 3080.00 |
|
| PH316500 | PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_000295) |
CNY 19520.00 |
|
| PH318781 | PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_696997) |
CNY 19520.00 |
|
| TP318781 | Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 3, 20 µg |
CNY 2900.00 |
