MSRB3 (NM_198080) Human Recombinant Protein
CAT#: TP316512
Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 1, 20 µg
View other "MSRB3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216512 representing NM_198080
Red=Cloning site Green=Tags(s) MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESA FEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGA HLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_932346 |
| Locus ID | 253827 |
| UniProt ID | Q8IXL7 |
| Refseq Size | 4242 |
| Cytogenetics | 12q14.3 |
| Refseq ORF | 576 |
| Synonyms | DFNB74 |
| Summary | The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403694 | MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422222 | MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403694 | Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 1 |
CNY 3080.00 |
|
| LY422222 | Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 2 |
CNY 3080.00 |
|
| PH308187 | MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_001026849) |
CNY 19520.00 |
|
| PH316512 | MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_932346) |
CNY 19520.00 |
|
| TP308187 | Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 2, 20 µg |
CNY 2900.00 |
