METTL21D (VCPKMT) (NM_001040662) Human Recombinant Protein
CAT#: TP316594
Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 2, 20 µg
View other "METTL21D" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216594 representing NM_001040662
Red=Cloning site Green=Tags(s) MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFEKFPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035752 |
Locus ID | 79609 |
UniProt ID | Q9H867 |
Refseq Size | 1679 |
Cytogenetics | 14q21.3 |
Refseq ORF | 582 |
Synonyms | C14orf138; METTL21D; VCP-KMT |
Summary | Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411191 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421803 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411191 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 1 |
CNY 3080.00 |
|
LY421803 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 2 |
CNY 3080.00 |
|
PH316594 | C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_001035752) |
CNY 19520.00 |
|
PH323670 | C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_078834) |
CNY 19520.00 |
|
TP323670 | Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 1, 20 µg |
CNY 2900.00 |
其它METTL21D产品