EFEMP1 (NM_001039348) Human Recombinant Protein
CAT#: TP316753
Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 20 µg
View other "EFEMP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216753 protein sequence
Red=Cloning site Green=Tags(s) MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC LPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIR RNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGE QCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCN QGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSVLRLTIIVGP FSF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034437 |
Locus ID | 2202 |
UniProt ID | Q12805 |
Refseq Size | 3094 |
Cytogenetics | 2p16.1 |
Refseq ORF | 1479 |
Synonyms | DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5 |
Summary | This gene encodes a member of the fibulin family of extracellular matrix glycoproteins. Like all members of this family, the encoded protein contains tandemly repeated epidermal growth factor-like repeats followed by a C-terminus fibulin-type domain. This gene is upregulated in malignant gliomas and may play a role in the aggressive nature of these tumors. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. Alternatively spliced transcript variants that encode the same protein have been described.[provided by RefSeq, Nov 2009] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418212 | EFEMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418212 | Transient overexpression lysate of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1 |
CNY 3080.00 |
|
PH304090 | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034438) |
CNY 19520.00 |
|
PH314953 | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004096) |
CNY 19520.00 |
|
PH316753 | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034437) |
CNY 14250.00 |
|
TP304090 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP314953 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 20 µg |
CNY 2900.00 |