Prostaglandin D Synthase (PTGDS) (NM_000954) Human Recombinant Protein
CAT#: TP316795L
Recombinant protein of human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
货期*
                        4周
                    规格
                        
                         推荐一起购买 (2)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC216795 representing NM_000954 
Red=Cloning site Green=Tags(s) MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 20.8 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_000945 | 
| Locus ID | 5730 | 
| UniProt ID | P41222 | 
| Refseq Size | 837 | 
| Cytogenetics | 9q34.3 | 
| Refseq ORF | 570 | 
| Synonyms | L-PGDS; LPGDS; PDS; PGD2; PGDS; PGDS2 | 
| Summary | The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008] | 
| Protein Pathways | Arachidonic acid metabolism, Metabolic pathways | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    其它Prostaglandin D Synthase产品
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        