SKAP55 (SKAP1) (NM_003726) Human Recombinant Protein
CAT#: TP317083
Recombinant protein of human src kinase associated phosphoprotein 1 (SKAP1), transcript variant 1, 20 µg
View other "SKAP55" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217083 representing NM_003726
Red=Cloning site Green=Tags(s) MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDD NHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLF YYYANEKSKQPKGTFLIKGYSVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLK DLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHD LEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYL TTAFEVEER myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003717 |
| Locus ID | 8631 |
| UniProt ID | Q86WV1 |
| Refseq Size | 1531 |
| Cytogenetics | 17q21.32 |
| Refseq ORF | 1077 |
| Synonyms | HEL-S-81p; SCAP1; SKAP55 |
| Summary | This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401226 | SKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421351 | SKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401226 | Transient overexpression lysate of src kinase associated phosphoprotein 1 (SKAP1), transcript variant 1 |
CNY 3080.00 |
|
| LY421351 | Transient overexpression lysate of src kinase associated phosphoprotein 1 (SKAP1), transcript variant 2 |
CNY 3080.00 |
|
| PH308493 | SKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001068567) |
CNY 19520.00 |
|
| PH317083 | SKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_003717) |
CNY 19520.00 |
|
| TP308493 | Recombinant protein of human src kinase associated phosphoprotein 1 (SKAP1), transcript variant 2, 20 µg |
CNY 2900.00 |
