DYNC1I1 (NM_004411) Human Recombinant Protein
CAT#: TP317108
Recombinant protein of human dynein, cytoplasmic 1, intermediate chain 1 (DYNC1I1), transcript variant 1, 20 µg
View other "DYNC1I1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217108 representing NM_004411
Red=Cloning site Green=Tags(s) MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP EPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSE LGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKE APPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFY DEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFAR FHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGI NCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLW NLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWVYDVGELAVPHNDEWTRFARTLVEIRA NRADSEEEGTVELSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 72.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004402 |
| Locus ID | 1780 |
| UniProt ID | O14576 |
| Refseq Size | 2950 |
| Cytogenetics | 7q21.3 |
| Refseq ORF | 1935 |
| Synonyms | DNCI1; DNCIC1 |
| Summary | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418005 | DYNC1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427617 | DYNC1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418005 | Transient overexpression lysate of dynein, cytoplasmic 1, intermediate chain 1 (DYNC1I1), transcript variant 1 |
CNY 4840.00 |
|
| LY427617 | Transient overexpression lysate of dynein, cytoplasmic 1, intermediate chain 1 (DYNC1I1), transcript variant 3 |
CNY 3080.00 |
|
| PH317108 | DYNC1I1 MS Standard C13 and N15-labeled recombinant protein (NP_004402) |
CNY 19520.00 |
其它DYNC1I1产品
