AFMID (NM_001010982) Human Recombinant Protein
CAT#: TP317126
Recombinant protein of human arylformamidase (AFMID), transcript variant 1, 20 µg
View other "AFMID" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217126 representing NM_001010982
Red=Cloning site Green=Tags(s) MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD GEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQ VTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLEPIVYTSQNVA LQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHF EIVENLTQKDNVLTQIILKTIFQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001010982 |
| Locus ID | 125061 |
| UniProt ID | Q63HM1 |
| Refseq Size | 1820 |
| Cytogenetics | 17q25.3 |
| Refseq ORF | 909 |
| Synonyms | FKF; KF; KFA |
| Summary | Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Tryptophan metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423254 | AFMID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423254 | Transient overexpression lysate of arylformamidase (AFMID), transcript variant 1 |
CNY 3080.00 |
|
| PH317126 | AFMID MS Standard C13 and N15-labeled recombinant protein (NP_001010982) |
CNY 19520.00 |
|
| TP760832 | Purified recombinant protein of Human arylformamidase (AFMID), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
