HIF1 beta (ARNT) (NM_178426) Human Recombinant Protein
CAT#: TP317284L
Purified recombinant protein of Homo sapiens aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217284 representing NM_178426
Red=Cloning site Green=Tags(s) MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_848513 |
| Locus ID | 405 |
| UniProt ID | P27540 |
| Refseq Size | 3563 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 984 |
| Synonyms | aryl hydrocarbon receptor nuclear translocator; bHLHe2; dioxin receptor, nuclear translocator; HIF-1beta; HIF1B; HIF1BETA; hypoxia-inducible factor 1, beta subunit; OTTHUMP00000032943; TANGO |
| Summary | This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
| SDS |
其它HIF1 beta产品


