Salivary alpha amylase (AMY1A) (NM_004038) Human Recombinant Protein
CAT#: TP317403
Recombinant protein of human amylase, alpha 1A (salivary) (AMY1A), transcript variant 1, 20 µg
View other "Salivary alpha amylase" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217403 representing NM_004038
Red=Cloning site Green=Tags(s) MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRD FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFR IDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF TRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA HFSISNSAEDPFIAIHAESKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004029 |
Locus ID | 276 |
UniProt ID | P04745, Q6NSB3 |
Refseq Size | 1862 |
Cytogenetics | 1p21.1 |
Refseq ORF | 1533 |
Synonyms | AMY1 |
Summary | Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Metabolic pathways, Starch and sucrose metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Determination of Molar Mass and Its Relationship with Free Energy of Activation: A Case Study on Human Salivary Alpha Amylase
,Udema, II;,
Journal of Scientific Research & Reports
[AMY1A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418295 | AMY1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423398 | AMY1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418295 | Transient overexpression lysate of amylase, alpha 1A (salivary) (AMY1A), transcript variant 1 |
CNY 3,080.00 |
|
LY423398 | Transient overexpression lysate of amylase, alpha 1A (salivary) (AMY1A), transcript variant 2 |
CNY 3,080.00 |
|
PH317403 | AMY1A MS Standard C13 and N15-labeled recombinant protein (NP_004029) |
CNY 19,520.00 |
其它Salivary alpha amylase产品