CDYL (NM_170752) Human Recombinant Protein
CAT#: TP317438
Recombinant protein of human chromodomain protein, Y-like (CDYL), transcript variant 3, 20 µg
View other "CDYL" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC217438 representing NM_170752 
Red=Cloning site Green=Tags(s) MDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLST KSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRN FVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASA NEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANER ECEVLKKIWGSAQGTDSMLKYMQRKIDEF myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 34.4 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_736608 | 
| Locus ID | 9425 | 
| UniProt ID | Q9Y232 | 
| Refseq Size | 2805 | 
| Cytogenetics | 6p25.1 | 
| Refseq ORF | 927 | 
| Synonyms | CDYL1, MGC131936, DKFZp586C1622 | 
| Summary | Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC406868 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC406869 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY406868 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY406869 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| PH317438 | CDYL MS Standard C13 and N15-labeled recombinant protein (NP_736608) | 
                                                     CNY 19520.00  | 
                                            
