TPRG1L (NM_182752) Human Recombinant Protein
CAT#: TP317457
Recombinant protein of human tumor protein p63 regulated 1-like (TPRG1L), 20 µg
View other "TPRG1L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217457 representing NM_182752
Red=Cloning site Green=Tags(s) MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGS IEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTEQSLLICKYDFISLQCQQVVRIALNAV DTISYGEFQFPPKSLNKREGFGIRIQWDKQSRPSFINRWNPWSTNVPYATFTEHPMAGADEKTASLCQLE SFKALLIQAVKKAQKESPLPGQANGVLILERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_877429 |
Locus ID | 127262 |
UniProt ID | Q5T0D9 |
Refseq Size | 2440 |
Cytogenetics | 1p36.32 |
Refseq ORF | 816 |
Synonyms | FAM79A; h-mover; mover |
Summary | Presynaptic protein involved in the synaptic transmission tuning. Regulates synaptic release probability by decreasing the calcium sensitivity of release.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405348 | TPRG1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405348 | Transient overexpression lysate of tumor protein p63 regulated 1-like (TPRG1L) |
CNY 3080.00 |
|
PH317457 | TPRG1L MS Standard C13 and N15-labeled recombinant protein (NP_877429) |
CNY 19520.00 |