GLIPR2 (NM_022343) Human Recombinant Protein
CAT#: TP317501
Recombinant protein of human GLI pathogenesis-related 2 (GLIPR2), 20 µg
View other "GLIPR2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217501 representing NM_022343
Red=Cloning site Green=Tags(s) MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV NEGFFEENVLPPKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071738 |
Locus ID | 152007 |
UniProt ID | Q9H4G4 |
Refseq Size | 1900 |
Cytogenetics | 9p13.3 |
Refseq ORF | 462 |
Synonyms | C9orf19; GAPR-1; GAPR1 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411714 | GLIPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411714 | Transient overexpression lysate of GLI pathogenesis-related 2 (GLIPR2) |
CNY 3080.00 |
|
PH317501 | GLIPR2 MS Standard C13 and N15-labeled recombinant protein (NP_071738) |
CNY 19520.00 |