FOXP3 (NM_014009) Human Recombinant Protein
CAT#: TP317580
Recombinant protein of human forkhead box P3 (FOXP3), transcript variant 1, 20 µg
View other "FOXP3" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 2 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217580 representing NM_014009
Red=Cloning site Green=Tags(s) MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSC CIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAI LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR PSRCSNPTPGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.1 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme substrate (PMID: 30054205) |
| Reference Data | |
| RefSeq | NP_054728 |
| Locus ID | 50943 |
| UniProt ID | Q9BZS1 |
| Refseq Size | 1869 |
| Cytogenetics | Xp11.23 |
| Refseq ORF | 1293 |
| Synonyms | AIID; DIETER; IPEX; JM2; PIDX; XPID |
| Summary | The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
PD-1 Inhibitory Receptor Downregulates Asparaginyl Endopeptidase and Maintains Foxp3 Transcription Factor Stability in Induced Regulatory T Cells
,Stathopoulou, C;Gangaplara, A;Mallett, G;Flomerfelt, FA;Liniany, LP;Knight, D;Samsel, LA;Berlinguer-Palmini, R;Yim, JJ;Felizardo, TC;Eckhaus, MA;Edgington-Mitchell, L;Martinez-Fabregas, J;Zhu, J;Fowler, DH;van Kasteren, SI;Laurence, A;Bogyo, M;Watts, C;Shevach, EM;Amarnath, S;,
Immunity
,PubMed ID 30054205
[FOXP3]
|
|
Functional characterization of Foxp3-specific spontaneous immune responses
,S K Larsen, S Munir, A Woetmann, T M Frøsig, N Odum, + et al.,
Leukemia doi:10.1038/leu.2013.196
,PubMed ID 23812418
[Foxp3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402270 | FOXP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426481 | FOXP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402270 | Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 1 |
CNY 4840.00 |
|
| LY426481 | Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 2 |
CNY 3080.00 |
|
| PH317580 | FOXP3 MS Standard C13 and N15-labeled recombinant protein (NP_054728) |
CNY 19520.00 |
|
| TP760693 | Purified recombinant protein of Human forkhead box P3 (FOXP3), transcript variant 2, (10ug), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |


