ACCN2 (ASIC1) (NM_001095) Human Recombinant Protein
CAT#: TP317623
Recombinant protein of human amiloride-sensitive cation channel 2, neuronal (ACCN2), transcript variant 2, 20 µg
View other "ACCN2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217623 protein sequence
Red=Cloning site Green=Tags(s) MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFH YHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQD KANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTM KGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL DFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDD VKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001086 |
| Locus ID | 41 |
| UniProt ID | P78348 |
| Refseq Size | 3873 |
| Cytogenetics | 12q13.12 |
| Refseq ORF | 1584 |
| Synonyms | ACCN2; ASIC; BNaC2 |
| Summary | This gene encodes a member of the acid-sensing ion channel (ASIC) family of proteins, which are part of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. Members of the ASIC family are sensitive to amiloride and function in neurotransmission. The encoded proteins function in learning, pain transduction, touch sensation, and development of memory and fear. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420121 | ASIC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY420121 | Transient overexpression lysate of amiloride-sensitive cation channel 2, neuronal (ACCN2), transcript variant 2 |
CNY 4840.00 |
|
| PH317623 | ACCN2 MS Standard C13 and N15-labeled recombinant protein (NP_001086) |
CNY 19520.00 |
