TRIM58 (NM_015431) Human Recombinant Protein
CAT#: TP317706
Recombinant protein of human tripartite motif-containing 58 (TRIM58), 20 µg
View other "TRIM58" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217706 protein sequence
Red=Cloning site Green=Tags(s) MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQCRGPFRPSGFR PNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDAGPEHRTHRTAPLQEAAGSYQ VKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERA TLQRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIP GRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEV LVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAG EISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056246 |
| Locus ID | 25893 |
| UniProt ID | Q8NG06 |
| Refseq Size | 2594 |
| Cytogenetics | 1q44 |
| Refseq ORF | 1458 |
| Synonyms | BIA2 |
| Summary | E3 ubiquitin ligase induced during late erythropoiesis. Directly binds and ubiquitinates the intermediate chain of the microtubule motor dynein (DYNC1LI1/DYNC1LI2), stimulating the degradation of the dynein holoprotein complex. May participate in the erythroblast enucleation process through regulation of nuclear polarization.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
TRIM58 Restrains Intestinal Mucosal Inflammation by Negatively Regulating TLR2 in Myeloid Cells
,null,
The Journal of Immunology Author Choice
,PubMed ID 31383741
[TRIM58]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402434 | TRIM58 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402434 | Transient overexpression lysate of tripartite motif-containing 58 (TRIM58) |
CNY 4840.00 |
|
| PH317706 | TRIM58 MS Standard C13 and N15-labeled recombinant protein (NP_056246) |
CNY 19520.00 |
