PTP epsilon (PTPRE) (NM_130435) Human Recombinant Protein
CAT#: TP317899
Recombinant protein of human protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 2, 20 µg
View other "PTP epsilon" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217899 representing NM_130435
Red=Cloning site Green=Tags(s) MSNRSSFSRLTWFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRS ADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGY KEKNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVV LVDYTIRKFCIQPQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAG VGRTGTFIVIDAMMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLE KHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEY TDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTH GEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQ QQTGNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQD FIDIFSDYANFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 74.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_569119 |
Locus ID | 5791 |
UniProt ID | P23469 |
Refseq Size | 5002 |
Cytogenetics | 10q26.2 |
Refseq ORF | 1926 |
Synonyms | HPTPE; PTPE; R-PTP-EPSILON |
Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Several alternatively spliced transcript variants of this gene have been reported, at least two of which encode a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokine-induced SATA signaling, as well as the activation of voltage-gated K+ channels. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401950 | PTPRE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408966 | PTPRE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401950 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 1 |
CNY 3080.00 |
|
LY408966 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 2 |
CNY 4840.00 |
|
PH307950 | PTPRE MS Standard C13 and N15-labeled recombinant protein (NP_006495) |
CNY 19520.00 |
|
PH317899 | PTPRE MS Standard C13 and N15-labeled recombinant protein (NP_569119) |
CNY 19520.00 |
|
TP307950 | Recombinant protein of human protein tyrosine phosphatase, receptor type, E (PTPRE), transcript variant 1, 20 µg |
CNY 2900.00 |
其它PTP epsilon产品