RBFOX1 (NM_018723) Human Recombinant Protein
CAT#: TP317960
Recombinant protein of human ataxin 2-binding protein 1 (A2BP1), transcript variant 4, 20 µg
View other "RBFOX1" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217960 representing NM_018723
Red=Cloning site Green=Tags(s) MNCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQ THSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQF GKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTNGWK LNPVVGAVYSPEFYAGTVLLCQANQEGSSMYSAPSSLVYTSAMPGFPYPAATAAAAYRGAHLRGRGRTVY NTFRAAAPPPPIPAYGGVVYQDGFYGADIYGGYAAYRYAQPTPATAAAYSDSYGRVYAADPYHHALAPAP TYGVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIYRGGYNRFAPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061193 |
Locus ID | 54715 |
UniProt ID | Q9NWB1, Q59HD3 |
Refseq Size | 2279 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1191 |
Synonyms | 2BP1; A2BP1; FOX-1; FOX1; HRNBP1 |
Summary | The Fox-1 family of RNA-binding proteins is evolutionarily conserved, and regulates tissue-specific alternative splicing in metazoa. Fox-1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. Fox-1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402712 | RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407829 | RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407830 | RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407831 | RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428042 | RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428043 | RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402712 | Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 4 |
CNY 3,080.00 |
|
LY407829 | Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 1 |
CNY 4,840.00 |
|
LY407830 | Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 2 |
CNY 3,080.00 |
|
LY407831 | Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 3 |
CNY 3,080.00 |
|
LY428042 | Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 5 |
CNY 3,080.00 |
|
LY428043 | Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 6 |
CNY 3,080.00 |
|
PH317960 | A2BP1 MS Standard C13 and N15-labeled recombinant protein (NP_061193) |
CNY 19,520.00 |
|
TP761105 | Purified recombinant protein of Human RNA binding protein, fox-1 homolog (C. elegans) 1 (RBFOX1), transcript variant 6, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |