RBP2 (NM_004164) Human Recombinant Protein
CAT#: TP317970
Recombinant protein of human retinol binding protein 2, cellular (RBP2), 20 µg
View other "RBP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217970 representing NM_004164
Red=Cloning site Green=Tags(s) MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004155 |
Locus ID | 5948 |
UniProt ID | P50120 |
Refseq Size | 700 |
Cytogenetics | 3q23 |
Refseq ORF | 402 |
Synonyms | CRABP-II; CRBP2; CRBPII; RBPC2 |
Summary | This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418171 | RBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418171 | Transient overexpression lysate of retinol binding protein 2, cellular (RBP2) |
CNY 3080.00 |
|
PH317970 | RBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004155) |
CNY 19520.00 |