JRK (NM_001077527) Human Recombinant Protein
CAT#: TP318013
Recombinant protein of human jerky homolog (mouse) (JRK), transcript variant 2, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218013 representing NM_001077527
Red=Cloning site Green=Tags(s) MASKPAAGKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSD SNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPCVFSGGWLWRFK ARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPTPEGGAVPGPK QGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKGIQHLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVR EHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVFTIFLPASVASLVQPMEQGIRRDFMRNFINPPVPL QGPHARYNMNDAIFSVACAWNAVPSHVFRRAWRKLWPSVAFAEGSSSEEELEAECFPVKPHNKSFAHILE LVKEGSSCPGQLRQRQAASWGVAGREAEGGRPPAATSPAEVVWSSEKTPKADQDGGGDPGEGEEVAWEQA AVAFDAVLRFAERQPCFSAQEVGQLRALRAVFRSQQQETVGLEDVVVTSPEELAIPKCCLEASTET myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 61.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001070995 |
| Locus ID | 8629 |
| UniProt ID | O75564 |
| Refseq Size | 3578 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 1668 |
| Synonyms | jerky; JH8 |
| Summary | This gene encodes a conserved protein that is similar to DNA-binding proteins, such as major centromere autoantigen B (CENPB). Inactivation of the related gene in mice resulted in epileptic seizures. Childhood Absence Epilepsy (CAE) has been mapped to the same chromosomal location (8q24.3) as this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418476 | JRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421459 | JRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418476 | Transient overexpression lysate of jerky homolog (mouse) (JRK), transcript variant 1 |
CNY 3080.00 |
|
| LY421459 | Transient overexpression lysate of jerky homolog (mouse) (JRK), transcript variant 2 |
CNY 4840.00 |
|
| PH318013 | JRK MS Standard C13 and N15-labeled recombinant protein (NP_001070995) |
CNY 19520.00 |
