CAMK2A (NM_015981) Human Recombinant Protein
CAT#: TP318186
Recombinant protein of human calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, 20 µg
View other "CAMK2A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218186 representing NM_015981
Red=Cloning site Green=Tags(s) MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIE DEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity regulator (PMID: 29486595) |
Reference Data | |
RefSeq | NP_057065 |
Locus ID | 815 |
UniProt ID | A8K161 |
Refseq Size | 4836 |
Cytogenetics | 5q32 |
Refseq ORF | 1467 |
Synonyms | CAMKA; CaMKIIalpha; CaMKIINalpha; MRD53; MRT63 |
Summary | The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2018] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Identification of Synaptic DGKθ Interactors That Stimulate DGKθ Activity
,null,
Frontiers in Synaptic Neuroscience
,PubMed ID 35573662
[CAMK2A]
|
Critical roles of Carbon Monoxide and Nitric Oxide in Ca2+ Signaling for Insulin Secretion in Pancreatic Islets
,Rahman, FU;Park, DR;Joe, Y;Jang, KY;Chung, HT;Kim, UH;,
Antioxid. Redox Signal.
,PubMed ID 29486595
[CAMK2A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406882 | CAMK2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406882 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 2 |
CNY 3080.00 |
|
PH305202 | CAMK2A MS Standard C13 and N15-labeled recombinant protein (NP_741960) |
CNY 19520.00 |
|
PH318186 | CAMK2A MS Standard C13 and N15-labeled recombinant protein (NP_057065) |
CNY 14250.00 |
|
TP305202 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 2, 20 µg |
CNY 2900.00 |