C14orf130 (UBR7) (NM_175748) Human Recombinant Protein
CAT#: TP318298
Recombinant protein of human ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2, 20 µg
View other "C14orf130" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218298 representing NM_175748
Red=Cloning site Green=Tags(s) MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM QYYCS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_786924 |
| Locus ID | 55148 |
| UniProt ID | Q8N806 |
| Refseq Size | 1576 |
| Cytogenetics | 14q32.12 |
| Refseq ORF | 1275 |
| Synonyms | C14orf130; LICAS |
| Summary | This gene encodes a UBR box-containing protein that belongs to the E3 ubiquitin ligase family. The protein also contains a plant homeodomain (PHD) in the C-terminus. In mammals, the encoded protein recognizes N-degrons, the destabilizing N-terminal residues of short-lived proteins, which results in ubiquitinylation, and proteolysis via the proteasome. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Manumycin Polyketides Act as Molecular Glues Between UBR7 and P53 to Impair Breast Cancer Pathogenicity
,Isobe, Y;Okumura, M;White, R;McGregor, LM;,
bioRxiv
[UBR7]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403580 | UBR7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420256 | UBR7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403580 | Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2 |
CNY 3080.00 |
|
| LY420256 | Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 3 |
CNY 3080.00 |
|
| PH318298 | UBR7 MS Standard C13 and N15-labeled recombinant protein (NP_786924) |
CNY 19520.00 |
其它C14orf130产品


