RGP1 (NM_001080496) Human Recombinant Protein
CAT#: TP318325
Recombinant protein of human RGP1 retrograde golgi transport homolog (S. cerevisiae) (RGP1), 20 µg
View other "RGP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218325 representing NM_001080496
Red=Cloning site Green=Tags(s) MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQP DVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTI GCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRS LHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPS VSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTW TGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001073965 |
| Locus ID | 9827 |
| UniProt ID | Q92546 |
| Refseq Size | 1296 |
| Cytogenetics | 9p13.3 |
| Refseq ORF | 1173 |
| Synonyms | KIAA0258 |
| Summary | The RIC1-RGP1 complex acts as a guanine nucleotide exchange factor (GEF), which activates RAB6A by exchanging bound GDP for free GTP and may thereby required for efficient fusion of endosome-derived vesicles with the Golgi compartment. The RIC1-RGP1 complex participates in the recycling of mannose-6-phosphate receptors.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421051 | RGP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY421051 | Transient overexpression lysate of RGP1 retrograde golgi transport homolog (S. cerevisiae) (RGP1) |
CNY 4840.00 |
|
| PH318325 | RGP1 MS Standard C13 and N15-labeled recombinant protein (NP_001073965) |
CNY 19520.00 |
