EXOSC3 (NM_001002269) Human Recombinant Protein
CAT#: TP318361L
Purified recombinant protein of Homo sapiens exosome component 3 (EXOSC3), transcript variant 2, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218361 representing NM_001002269
Red=Cloning site Green=Tags(s) MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS LSYLSFEGATKRNRPNVQAISSRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002269 |
Locus ID | 51010 |
UniProt ID | Q9NQT5 |
Refseq Size | 1070 |
Cytogenetics | 9p13.2 |
Refseq ORF | 492 |
Synonyms | bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p |
Summary | This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |