CMTM7 (NM_181472) Human Recombinant Protein
CAT#: TP318395
Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2, 20 µg
View other "CMTM7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218395 representing NM_181472
Red=Cloning site Green=Tags(s) MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTN YSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSIFGFMATFLCMASIWLSYKISCVTQSTDA AV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_852137 |
| Locus ID | 112616 |
| UniProt ID | Q96FZ5 |
| Refseq Size | 1270 |
| Cytogenetics | 3p22.3 |
| Refseq ORF | 426 |
| Synonyms | CKLFSF7 |
| Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408668 | CMTM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408668 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 1 |
CNY 3080.00 |
|
| PH318395 | CMTM7 MS Standard C13 and N15-labeled recombinant protein (NP_852137) |
CNY 14250.00 |
