TNFAIP8L3 (NM_207381) Human Recombinant Protein
CAT#: TP318511
Recombinant protein of human tumor necrosis factor, alpha-induced protein 8-like 3 (TNFAIP8L3), 20 µg
View other "TNFAIP8L3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218511 representing NM_207381
Red=Cloning site Green=Tags(s) MGKPRQNPSTLVSTLCEAEPKGKLWVNGYAGTQGTRDATLQTRLIPLSFHLQRGKGLAAPLSALSAPRLP ERPADGRVAVDAQPAARSMDSDSGEQSEGEPVTAAGPDVFSSKSLALQAQKKILSKIASKTVANMLIDDT SSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSF YEVEYTFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRIC EGINKLLDEKVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997264 |
Locus ID | 388121 |
UniProt ID | Q5GJ75 |
Refseq Size | 2292 |
Cytogenetics | 15q21.2 |
Refseq ORF | 876 |
Synonyms | TIPE3 |
Summary | Acts as a lipid transfer protein. Preferentially captures and shuttles two lipid second messengers, i.e., phosphatidylinositol 4,5- bisphosphate and phosphatidylinositol 3,4,5-trisphosphate and increases their levels in the plasma membrane. Additionally, may also function as a lipid-presenting protein to enhance the activity of the PI3K-AKT and MEK-ERK pathways. May act as a regulator of tumorigenesis through its activation of phospholipid signaling.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403998 | TNFAIP8L3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403998 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8-like 3 (TNFAIP8L3) |
CNY 3080.00 |
|
PH318511 | TNFAIP8L3 MS Standard C13 and N15-labeled recombinant protein (NP_997264) |
CNY 19520.00 |
其它TNFAIP8L3产品