C8orf58 (NM_001013842) Human Recombinant Protein
CAT＃: TP318522
Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), 20 µg
View other "C8orf58" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218522 representing NM_001013842
Red=Cloning site Green=Tags(s) MMGRRRAFAVDGRDGAGEGLARGCIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSG VEMAVGDSPLAALPGLSQDSLDFESSGSSEPPAQVGRLLASQKLGEVLERSRRLPTAPTSLSGQHRSLRL ASKPEREVPLGAGQQESMEADTDLEAGLEEEAVGGLGPGAWACLPGQGLRYLEHLCLVLEQMARLQQLYL QLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPETPV EPTYHLPSSQGHKRDISHWDKVKVLLNRICRRSHHHPEPPAPPDGSDPRIESRDLPERPQCRPHRKTFMP SLVVKKQRAKNLSVG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001013864 |
| Locus ID | 541565 |
| UniProt ID | Q8NAV2 |
| Refseq Size | 2075 |
| Cytogenetics | 8p21.3 |
| Refseq ORF | 1095 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423043 | C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434144 | C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434181 | C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423043 | Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58) |
CNY 3080.00 |
|
| LY434144 | Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 3 |
CNY 3080.00 |
|
| LY434181 | Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 2 |
CNY 3080.00 |
|
| PH318522 | C8orf58 MS Standard C13 and N15-labeled recombinant protein (NP_001013864) |
CNY 14250.00 |
|
| TP331145 | Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), transcript variant 3, 20 µg |
CNY 2900.00 |
其它C8orf58产品
