SPRED3 (NM_001039616) Human Recombinant Protein
CAT#: TP318601
Recombinant protein of human sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 2, 20 µg
View other "SPRED3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218601 representing NM_001039616
Red=Cloning site Green=Tags(s) MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGL VYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPL TLSQYFRHMLCP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001034705 |
| Locus ID | 399473 |
| UniProt ID | Q2MJR0 |
| Refseq Size | 543 |
| Cytogenetics | 19q13.2 |
| Refseq ORF | 456 |
| Synonyms | Eve-3; spred-3 |
| Summary | This gene encodes a protein with a C-terminal Sprouty-like cysteine-rich domain (SRY) and an N-terminal Ena/Vasodilator-stimulated phosphoprotein (VASP) homology-1 (EVH-1) domain. The encoded protein is a member of a family of proteins that negatively regulates mitogen-activated protein (MAP) kinase signaling, particularly during organogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420960 | SPRED3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422092 | SPRED3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420960 | Transient overexpression lysate of sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 1 |
CNY 3080.00 |
|
| LY422092 | Transient overexpression lysate of sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 2 |
CNY 3080.00 |
|
| PH318601 | SPRED3 MS Standard C13 and N15-labeled recombinant protein (NP_001034705) |
CNY 19520.00 |
