TRAF3 (NM_003300) Human Recombinant Protein
CAT#: TP318682
Recombinant protein of human TNF receptor-associated factor 3 (TRAF3), transcript variant 3, 20 µg
View other "TRAF3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218682 protein sequence
Red=Cloning site Green=Tags(s) MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGH RFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKND CHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSV QTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNE SVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF KQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV DTSDLPDP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 64.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003291 |
Locus ID | 7187 |
UniProt ID | Q13114 |
Refseq Size | 7654 |
Cytogenetics | 14q32.32 |
Refseq ORF | 1704 |
Synonyms | CAP-1; CAP1; CD40bp; CRAF1; IIAE5; LAP1; RNF118 |
Summary | The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. The protein also plays a role in the regulation of antiviral response. Mutations in this are associated with Encephalopathy, acute, infection-induced, herpes-specific 5. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome |
Protein Pathways | Pathways in cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, Toll-like receptor signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
E3 ligase Nedd4l promotes antiviral innate immunity by catalyzing K29-linked cysteine ubiquitination of TRAF3
,Gao, P;Ma, X;Yuan, M;Yi, Y;Liu, G;Wen, M;Jiang, W;Ji, R;Zhu, L;Tang, Z;Yu, Q;Xu, J;Yang, R;Xia, S;Yang, M;Pan, J;Yuan, H;An, H;,
Nature communications
,PubMed ID 33608556
[TRAF3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403439 | TRAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418781 | TRAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403439 | Transient overexpression lysate of TNF receptor-associated factor 3 (TRAF3), transcript variant 1 |
CNY 3080.00 |
|
LY418781 | Transient overexpression lysate of TNF receptor-associated factor 3 (TRAF3), transcript variant 3 |
CNY 3080.00 |
|
PH318682 | TRAF3 MS Standard C13 and N15-labeled recombinant protein (NP_003291) |
CNY 19520.00 |