MRAP (NM_206898) Human Recombinant Protein
CAT#: TP318683
Purified recombinant protein of Homo sapiens melanocortin 2 receptor accessory protein (MRAP), transcript variant 2, 20 µg
View other "MRAP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218683 representing NM_206898
Red=Cloning site Green=Tags(s) MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSASPQMSF NTDESLLHSEVLPQTRAISCDELQAPREEGAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996781 |
Locus ID | 56246 |
UniProt ID | Q8TCY5 |
Refseq Size | 656 |
Cytogenetics | 21q22.11 |
Refseq ORF | 306 |
Synonyms | B27; C21orf61; FALP; FGD2; GCCD2 |
Summary | This gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404158 | MRAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404158 | Transient overexpression lysate of melanocortin 2 receptor accessory protein (MRAP), transcript variant 2 |
CNY 3080.00 |
|
PH318683 | MRAP MS Standard C13 and N15-labeled recombinant protein (NP_996781) |
CNY 14250.00 |