PROP1 (NM_006261) Human Recombinant Protein
CAT#: TP318746
Recombinant protein of human PROP paired-like homeobox 1 (PROP1), 20 µg
View other "PROP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 3 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218746 protein sequence
Red=Cloning site Green=Tags(s) MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHSRR RHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSP AAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPP PPPMLPLSLEPSKSWN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006252 |
| Locus ID | 5626 |
| UniProt ID | O75360 |
| Refseq Size | 1464 |
| Cytogenetics | 5q35.3 |
| Refseq ORF | 678 |
| Synonyms | CPHD2; PROP-1 |
| Summary | This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone expression. Mutations in this gene have been associated with combined pituitary hormone deficiency-2 as well as deficiencies in luteinizing hormone, follicle-stimulating hormone, growth hormone, prolactin, and thyroid-stimulating hormone. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome, Transcription Factors |
Citations (3)
| The use of this Proteins has been cited in the following citations: |
|---|
|
DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD
,Klingler, C;Ashley, J;Shi, K;Stiefvater, A;Kyba, M;Sinnreich, M;Aihara, H;Kinter, J;,
FASEB J.
,PubMed ID 32020675
[PROP1]
|
|
Involvement of PIT-1-reactive cytotoxic T lymphocytes in anti-PIT-1 antibody syndrome
,Bando, H;Iguchi, G;Fukuoka, H;Yamamoto, M;Hidaka-Takeno, R;Okimura, Y;Matsumoto, R;Suda, K;Nishizawa, H;Takahashi, M;Tojo, K;Takahashi, Y;,
J. Clin. Endocrinol. Metab.
,PubMed ID 24937538
[PROP1]
|
|
Involvement of PIT-1-Reactive Cytotoxic TLymphocytes in Anti-PIT-1 Antibody Syndrome
,Bando, H;Iguchi, G;Fukuoka, H;,
J Clin Endocrinol Metab
[PROP1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416763 | PROP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416763 | Transient overexpression lysate of PROP paired-like homeobox 1 (PROP1) |
CNY 3080.00 |
|
| PH318746 | PROP1 MS Standard C13 and N15-labeled recombinant protein (NP_006252) |
CNY 19520.00 |

