UBE2D2 (NM_003339) Human Recombinant Protein
CAT#: TP318795
Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1, 20 µg
View other "UBE2D2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218795 protein sequence
Red=Cloning site Green=Tags(s) MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE WTQKYAM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003330 |
| Locus ID | 7322 |
| UniProt ID | P62837 |
| Refseq Size | 2715 |
| Cytogenetics | 5q31.2 |
| Refseq ORF | 441 |
| Synonyms | E2(17)KB2; PUBC1; UBC4; UBC4/5; UBCH4; UBCH5B |
| Summary | Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405611 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418757 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405611 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2 |
CNY 3080.00 |
|
| LY418757 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1 |
CNY 3080.00 |
|
| PH307283 | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_862821) |
CNY 19520.00 |
|
| PH318795 | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_003330) |
CNY 19520.00 |
|
| TP307283 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2, 20 µg |
CNY 2900.00 |


