ADAMTSL1 (NM_052866) Human Recombinant Protein
CAT#: TP318828
Purified recombinant protein of Homo sapiens ADAMTS-like 1 (ADAMTSL1), transcript variant 2, 20 µg
View other "ADAMTSL1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218828 protein sequence
Red=Cloning site Green=Tags(s) MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRN IRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLD GTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPY GSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIR NSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPK LQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC MYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKPHIKEECIVPT PCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_443098 |
| Locus ID | 92949 |
| UniProt ID | Q8N6G6 |
| Refseq Size | 1810 |
| Cytogenetics | 9p22.2-p22.1 |
| Refseq ORF | 1575 |
| Synonyms | ADAMTSL-1; ADAMTSR1; C9orf94; PUNCTIN |
| Summary | This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409424 | ADAMTSL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY409424 | Transient overexpression lysate of ADAMTS-like 1 (ADAMTSL1), transcript variant 2 |
CNY 4840.00 |
|
| PH318828 | ADAMTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_443098) |
CNY 14250.00 |
|
| TP761080 | Purified recombinant protein of Human ADAMTS-like 1 (ADAMTSL1), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它ADAMTSL1产品
